DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdha and PRS4

DIOPT Version :9

Sequence 1:NP_726945.1 Gene:Pdha / 31406 FlyBaseID:FBgn0028325 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_009485.3 Gene:PRS4 / 852211 SGDID:S000000164 Length:326 Species:Saccharomyces cerevisiae


Alignment Length:436 Identity:79/436 - (18%)
Similarity:134/436 - (30%) Gaps:170/436 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PIIVKQLQKRCHNNNNNNIIISGCRILSNNNNNSSIDIIRNGRYSSSFFGLFQNAAQAGV--SKT 74
            |.:.:|:.|:.      .|.:|...:...:|..:|:.|..:.|....:.      .|.|:  .:.
Yeast    23 PDLAEQISKKL------GIPLSKVGVYQYSNKETSVTIGESLRDEDVYI------IQTGIGEQEI 75

  Fly    75 NNYATE----------------ATVQVNRPFKLHRLDEGPATEVKLTKDQALKYYTQMQTIRRLE 123
            |::..|                .||..|.|:.  |.|:         ||::....|.......|:
Yeast    76 NDFLMELLILIHACKIASARKITTVIPNFPYA--RQDK---------KDKSRAPITAKLVANLLQ 129

  Fly   124 TAAG------NLYKEKIIRGFCH-----LYSGQEACAVGMKAAMRDVDNIISAYRVHGWTYLMGV 177
            ||..      :|:..: |:||.|     ||:  |...:.......|.||.|.            |
Yeast   130 TAGADHVITMDLHASQ-IQGFFHIPVDNLYA--EPSVLNYIRTKTDFDNAIL------------V 179

  Fly   178 SPSGVLAELTGVQGGCARGKGGSMHMYAPNFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALY 242
            ||..                ||:..:.|         :..::.|...:....:.|.|....:.|.
Yeast   180 SPDA----------------GGAKRVAA---------LADKLDLNFALIHKERQKANEVSKMVLV 219

  Fly   243 GDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERASCNTDYYTRGDALPGIWVDGMDV 307
            ||          ..|.:.|....:...|                            |..|...|.
Yeast   220 GD----------VTNKSCLLVDDMADTC----------------------------GTLVKACDT 246

  Fly   308 LAVRSATEFAINYVNTHGPLVMETNTYRYSGHSMSDPGTSYRTREEIQEVRQKRDPITSFKELCI 372
            |....|.|  :..:.|||         .:||.:          ||:::..|..|           
Yeast   247 LMEHGAKE--VIAIVTHG---------IFSGSA----------REKLRNSRLSR----------- 279

  Fly   373 ELGLITTDEVKA-IDLKVRKEVDEATAFAKSDAEL----GVSHLWT 413
               ::.|:.|.. :||.:..::|.:..||::...|    .||:|:|
Yeast   280 ---IVCTNTVPVDLDLPIADQIDISPTFAEAIRRLHNGESVSYLFT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhaNP_726945.1 TPP_enzymes 78..426 CDD:294952 67/368 (18%)
PRS4NP_009485.3 PrsA 11..322 CDD:223538 78/434 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.