DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pdha and PRPSAP1

DIOPT Version :9

Sequence 1:	NP_726945.1	Gene:	Pdha / 31406	FlyBaseID:	FBgn0028325	Length:	443	Species:	Drosophila melanogaster
Sequence 2:	NP_002757.2	Gene:	PRPSAP1 / 5635	HGNCID:	9466	Length:	385	Species:	Homo sapiens

Alignment Length:	122	Identity:	29/122 - (23%)
Similarity:	53/122 - (43%)	Gaps:	27/122 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly   338 GHSMSDPGTSYRTREEIQE-VRQK---------RDPITSFKELCIELGLITTDEVKAI------- 385
            |.|:....|:..||.||:| ||.:         ||..|:..||.|....:.|...:.|
Human    64 GKSVVYQETNGETRVEIKESVRGQDIFIIQTIPRDVNTAVMELLIMAYALKTACARNIIGVIPYF 128

  Fly   386 ----DLKVRKEVD-EATAFAKSDAELGVSHLWT-DVYSNNLEPKLRGTIAYDIDHIQ 436
                ..|:||... .....|...|:.|::|:.| |::    :.:::|..::.:|:::
Human   129 PYSKQSKMRKRGSIVCKLLASMLAKAGLTHIITMDLH----QKEIQGFFSFPVDNLR 181

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pdha	NP_726945.1	TPP_enzymes	78..426	CDD:294952	27/110 (25%)
PRPSAP1	NP_002757.2	PrsA	37..379	CDD:223538	29/122 (24%)
		Pribosyltran_N	38..155	CDD:290508	23/90 (26%)
		Pribosyl_synth	196..379	CDD:291252
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0462
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900