DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdha and CG8199

DIOPT Version :9

Sequence 1:NP_726945.1 Gene:Pdha / 31406 FlyBaseID:FBgn0028325 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_649905.1 Gene:CG8199 / 41149 FlyBaseID:FBgn0037709 Length:439 Species:Drosophila melanogaster


Alignment Length:416 Identity:114/416 - (27%)
Similarity:167/416 - (40%) Gaps:70/416 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SSFFGLFQNAAQAGVSKTN-----NYATEATVQVNRPFKLHRLDEGPATEVKLTKDQAL------ 110
            |..:..|..|....|||.|     :||         |..::|:.:........|:|..|      
  Fly    40 SEDYANFPGAKAPFVSKLNLIQPEDYA---------PIPIYRVMDQDGYIADETQDPQLGREVVE 95

  Fly   111 KYYTQMQTIRRLETAAGNLYKEKIIRGFCHLYS---GQEACAVGMKAAMRDVDNIISAYRVHGWT 172
            |.:..|..:..::..   || |...:|....|.   |:||..:|..||:...|.|...||..|..
  Fly    96 KMFRDMVLLNTMDKI---LY-ESQRQGRISFYMTNFGEEASHIGSAAALEMRDLIYGQYREAGVL 156

  Fly   173 YLMGVSPSGVLAELTGVQGGCARGKGGSMHMYAP---NFYGGNGIVGAQVPLGAGVGLACKYKGN 234
            ...|......:.:..|......|||...:| |..   ||...:..:..|:|...|...|.|.:.|
  Fly   157 VWRGFRIDQFIDQCYGNTDDLGRGKQMPVH-YGSRELNFVTISSPLSTQMPQAVGAAYAMKLRPN 220

  Fly   235 GGMCLALY-GDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERASCNTDYYTRGDALP 298
            ...|:..| |:|||::|....|:|.|.....|.|..|.||.:.:.|.|.      :.| :||.:.
  Fly   221 NDACVVCYFGEGAASEGDAHAAFNFAATLGCPAILFCRNNGFAISTPSH------EQY-KGDGIA 278

  Fly   299 G----------IWVDGMDVLAVRSATEFAINYV-NTHGPLVMETNTYRYSGHSMSDPGTSYRTRE 352
            |          |.|||.||.||.:|.:.|..|| ..:.|:|.|...||...||.||..|:||..|
  Fly   279 GRGPMGYGITTIRVDGTDVFAVYNAMKAAREYVLKENKPVVFEALAYRVGHHSTSDDSTAYRPAE 343

  Fly   353 EIQEVRQKRDPITSFKELCIELG----LITTDEVKAIDLKVRKEVDEATAFAKSDAELGVSHLWT 413
            ||:.......||:..|...:..|    .:..:.||.|..||.|::      |.|:.:|..:  |.
  Fly   344 EIEIWNSVEHPISKLKRYMVHKGWFDETVENEYVKDIRKKVLKQI------AVSEKKLKPN--WR 400

  Fly   414 DVYSNNLEPKLRGTIAYDIDHIQERK 439
            :::        .|..|...||:.|::
  Fly   401 EMF--------EGVYAEMPDHLIEQR 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhaNP_726945.1 TPP_enzymes 78..426 CDD:294952 101/375 (27%)
CG8199NP_649905.1 TPP_E1_PDC_ADC_BCADC 97..389 CDD:238958 90/309 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.