DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdha and PRPS1L1

DIOPT Version :9

Sequence 1:NP_726945.1 Gene:Pdha / 31406 FlyBaseID:FBgn0028325 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_787082.1 Gene:PRPS1L1 / 221823 HGNCID:9463 Length:318 Species:Homo sapiens


Alignment Length:65 Identity:13/65 - (20%)
Similarity:26/65 - (40%) Gaps:19/65 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YSSSFFGLFQNAAQAGVSKTNNYATEATVQVNRPFKLHRLDEGPATEVKLTKDQALKYYTQMQTI 119
            |:....|:|...|   :|:.|....||.|..|                .:.:|:.:|:.::::.|
Human   245 YAILTHGIFSGPA---ISRINTACFEAVVVTN----------------TIPQDEKMKHCSKIRVI 290

  Fly   120  119
            Human   291  290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhaNP_726945.1 TPP_enzymes 78..426 CDD:294952 7/42 (17%)
PRPS1L1NP_787082.1 PrsA 1..313 CDD:223538 13/65 (20%)
Pribosyltran_N 4..120 CDD:290508
PRTases_typeI 161..313 CDD:294217 13/65 (20%)
Binding of phosphoribosylpyrophosphate. /evidence=ECO:0000255 212..227
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.