DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and DYNLL1

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001032583.1 Gene:DYNLL1 / 8655 HGNCID:15476 Length:89 Species:Homo sapiens


Alignment Length:89 Identity:84/89 - (94%)
Similarity:88/89 - (98%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65
            |.||||||||||||||||||:|:|||||||||||||||||:||||||||||||||||||||||||
Human     1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSY 65

  Fly    66 VTHETRHFIYFYLGQVAILLFKSG 89
            |||||:||||||||||||||||||
Human    66 VTHETKHFIYFYLGQVAILLFKSG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 82/87 (94%)
DYNLL1NP_001032583.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 78/82 (95%)
Interaction with ESR1. /evidence=ECO:0000269|PubMed:15891768 67..89 20/21 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159085
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53822
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 1 1.000 - - FOG0001307
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101264
Panther 1 1.100 - - O PTHR11886
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R360
SonicParanoid 1 1.000 - - X523
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.