DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and DYN2

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_010712.1 Gene:DYN2 / 852034 SGDID:S000002832 Length:92 Species:Saccharomyces cerevisiae


Alignment Length:91 Identity:44/91 - (48%)
Similarity:67/91 - (73%) Gaps:3/91 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRK---AVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNF 62
            |||..   .::|.:|:::::::|.:..:..||:||.:|:|||..:||:.|.||..|||.|||:||
Yeast     1 MSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNF 65

  Fly    63 GSYVTHETRHFIYFYLGQVAILLFKS 88
            |||||||..||:|||:|.:|.|:||:
Yeast    66 GSYVTHEKGHFVYFYIGPLAFLVFKT 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 44/91 (48%)
DYN2NP_010712.1 DLC-like_DYNLL1_DYNLL2 8..91 CDD:412000 40/82 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346227
Domainoid 1 1.000 103 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I1435
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53822
OrthoFinder 1 1.000 - - FOG0001307
OrthoInspector 1 1.000 - - otm46858
orthoMCL 1 0.900 - - OOG6_101264
Panther 1 1.100 - - LDO PTHR11886
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R360
SonicParanoid 1 1.000 - - X523
TreeFam 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.