DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and AT1G23220

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_173736.1 Gene:AT1G23220 / 838931 AraportID:AT1G23220 Length:129 Species:Arabidopsis thaliana


Alignment Length:84 Identity:35/84 - (41%)
Similarity:50/84 - (59%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IKNADMSEEMQQDAVDCATQALEKYNIEKD---IAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHE 69
            ::.:||....|..|...:.:.|.....:.|   :|..:||:||..|.|.||||||.:|||||||.
plant    38 VRASDMPLPQQNRAFSLSREILNATPGKADNKRLAHALKKDFDSAYGPAWHCIVGTSFGSYVTHS 102

  Fly    70 TRHFIYFYLGQVAILLFKS 88
            |..|:||.:.:|.:||||:
plant   103 TGGFLYFQIDKVYVLLFKT 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 35/84 (42%)
AT1G23220NP_173736.1 PLN03058 1..128 CDD:166697 35/84 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11886
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.