DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and AT1G23220

DIOPT Version :10

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_173736.1 Gene:AT1G23220 / 838931 AraportID:AT1G23220 Length:129 Species:Arabidopsis thaliana


Alignment Length:84 Identity:35/84 - (41%)
Similarity:50/84 - (59%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IKNADMSEEMQQDAVDCATQALEKYNIEKD---IAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHE 69
            ::.:||....|..|...:.:.|.....:.|   :|..:||:||..|.|.||||||.:|||||||.
plant    38 VRASDMPLPQQNRAFSLSREILNATPGKADNKRLAHALKKDFDSAYGPAWHCIVGTSFGSYVTHS 102

  Fly    70 TRHFIYFYLGQVAILLFKS 88
            |..|:||.:.:|.:||||:
plant   103 TGGFLYFQIDKVYVLLFKT 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 34/82 (41%)
AT1G23220NP_173736.1 PLN03058 1..128 CDD:166697 35/84 (42%)

Return to query results.
Submit another query.