DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and AT5G20110

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_197511.1 Gene:AT5G20110 / 832133 AraportID:AT5G20110 Length:209 Species:Arabidopsis thaliana


Alignment Length:81 Identity:42/81 - (51%)
Similarity:54/81 - (66%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ADMSEEMQQDAVDCA---TQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRH 72
            |||...||..|..||   ..:|||:: .|.:|..:||||||.|.|.||||||.:|||:|||.|..
plant   122 ADMPGFMQAHAFRCARMTLDSLEKFS-SKHMAFNLKKEFDKGYGPAWHCIVGSSFGSFVTHSTGC 185

  Fly    73 FIYFYLGQVAILLFKS 88
            ||||.:.::.:||||:
plant   186 FIYFSMDKLYVLLFKT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 42/81 (52%)
AT5G20110NP_197511.1 Dynein_light 87..205 CDD:413603 42/81 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11886
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.