DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and AT4G15930

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_193328.4 Gene:AT4G15930 / 827275 AraportID:AT4G15930 Length:123 Species:Arabidopsis thaliana


Alignment Length:86 Identity:60/86 - (69%)
Similarity:74/86 - (86%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTH 68
            ::||||:|||.::||::|::.|..|.|||::|||||..||||||||:..||||||||||||||||
plant    38 KRAVIKSADMKDDMQKEAIEIAISAFEKYSVEKDIAENIKKEFDKKHGATWHCIVGRNFGSYVTH 102

  Fly    69 ETRHFIYFYLGQVAILLFKSG 89
            ||.||:||||.|.|:||||||
plant   103 ETNHFVYFYLDQKAVLLFKSG 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 58/84 (69%)
AT4G15930NP_193328.4 DLC-like_SF 39..122 CDD:425407 57/82 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 132 1.000 Domainoid score I1665
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I1821
OMA 1 1.010 - - QHG53822
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 1 1.000 - - FOG0001307
OrthoInspector 1 1.000 - - otm3498
orthoMCL 1 0.900 - - OOG6_101264
Panther 1 1.100 - - LDO PTHR11886
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X523
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.