DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and Dynll2

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001161943.1 Gene:Dynll2 / 68097 MGIID:1915347 Length:89 Species:Mus musculus


Alignment Length:89 Identity:86/89 - (96%)
Similarity:89/89 - (100%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65
            |||||||||||||||:||||||||||||:||||||||||||||||||||||||||||||||||||
Mouse     1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65

  Fly    66 VTHETRHFIYFYLGQVAILLFKSG 89
            |||||:||||||||||||||||||
Mouse    66 VTHETKHFIYFYLGQVAILLFKSG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 84/87 (97%)
Dynll2NP_001161943.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 79/82 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849454
Domainoid 1 1.000 174 1.000 Domainoid score I3662
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115597
Inparanoid 1 1.050 184 1.000 Inparanoid score I3939
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53822
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 1 1.000 - - FOG0001307
OrthoInspector 1 1.000 - - otm43716
orthoMCL 1 0.900 - - OOG6_101264
Panther 1 1.100 - - LDO PTHR11886
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R360
SonicParanoid 1 1.000 - - X523
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.