DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and LOC679822

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_038942941.1 Gene:LOC679822 / 679822 RGDID:1583666 Length:89 Species:Rattus norvegicus


Alignment Length:89 Identity:62/89 - (69%)
Similarity:70/89 - (78%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65
            |.|.|.||.||||||.||||:|:.|.|||||.::||.|||..|:|.|||.|||.||||||..|||
  Rat     1 MCDWKVVITNADMSEGMQQDSVERAAQALEKCSMEKGIAAPSKEESDKKSNPTRHCIVGRTSGSY 65

  Fly    66 VTHETRHFIYFYLGQVAILLFKSG 89
            .||||:.||:|.|||||:||||||
  Rat    66 GTHETKPFIHFSLGQVAVLLFKSG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 60/87 (69%)
LOC679822XP_038942941.1 Dynein_light 1..89 CDD:413603 60/87 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53822
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 1 1.000 - - FOG0001307
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101264
Panther 1 1.100 - - O PTHR11886
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X523
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.