DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and Dynll1

DIOPT Version :10

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_445771.1 Gene:Dynll1 / 58945 RGDID:619866 Length:89 Species:Rattus norvegicus


Alignment Length:89 Identity:84/89 - (94%)
Similarity:88/89 - (98%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65
            |.||||||||||||||||||:|:|||||||||||||||||:||||||||||||||||||||||||
  Rat     1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSY 65

  Fly    66 VTHETRHFIYFYLGQVAILLFKSG 89
            |||||:||||||||||||||||||
  Rat    66 VTHETKHFIYFYLGQVAILLFKSG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 78/82 (95%)
Dynll1NP_445771.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 78/82 (95%)
Interaction with ESR1. /evidence=ECO:0000250 67..89 20/21 (95%)

Return to query results.
Submit another query.