Sequence 1: | NP_001356933.1 | Gene: | ctp / 31405 | FlyBaseID: | FBgn0011760 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062656.3 | Gene: | Dynll1 / 56455 | MGIID: | 1861457 | Length: | 89 | Species: | Mus musculus |
Alignment Length: | 89 | Identity: | 84/89 - (94%) |
---|---|---|---|
Similarity: | 88/89 - (98%) | Gaps: | 0/89 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65
Fly 66 VTHETRHFIYFYLGQVAILLFKSG 89 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ctp | NP_001356933.1 | PTZ00059 | 1..89 | CDD:185421 | 82/87 (94%) |
Dynll1 | NP_062656.3 | DLC-like_DYNLL1_DYNLL2 | 5..88 | CDD:412000 | 78/82 (95%) |
Interaction with ESR1. /evidence=ECO:0000250 | 67..89 | 20/21 (95%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167849455 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3430 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53822 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001307 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_101264 | |
Panther | 1 | 1.100 | - | - | O | PTHR11886 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R360 |
SonicParanoid | 1 | 1.000 | - | - | X523 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
10 | 9.780 |