DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and Dnal4

DIOPT Version :10

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001423237.1 Gene:Dnal4 / 54152 MGIID:1859217 Length:139 Species:Mus musculus


Alignment Length:64 Identity:23/64 - (35%)
Similarity:40/64 - (62%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VIKNADMSEEMQQDAVDCATQALEKY-NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHE 69
            :::::||.|||:.:.::....|.||: |..:..|..||:..|||:..:||.::|..||..:|||
Mouse    21 LVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHE 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 23/64 (36%)
Dnal4NP_001423237.1 DLC-like_DNAL4 21..>87 CDD:412001 23/64 (36%)

Return to query results.
Submit another query.