DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and dynll1

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001005077.1 Gene:dynll1 / 448652 XenbaseID:XB-GENE-854521 Length:89 Species:Xenopus tropicalis


Alignment Length:89 Identity:85/89 - (95%)
Similarity:89/89 - (100%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65
            ||:||||||||||||||||||||||||||||:||||||||:||||||||||||||||||||||||
 Frog     1 MSERKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSY 65

  Fly    66 VTHETRHFIYFYLGQVAILLFKSG 89
            |||||:||||||||||||||||||
 Frog    66 VTHETKHFIYFYLGQVAILLFKSG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 83/87 (95%)
dynll1NP_001005077.1 PTZ00059 1..89 CDD:185421 83/87 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I3852
OMA 1 1.010 - - QHG53822
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 1 1.000 - - FOG0001307
OrthoInspector 1 1.000 - - otm48888
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R360
SonicParanoid 1 1.000 - - X523
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.