DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and dnal4

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001006784.1 Gene:dnal4 / 448476 XenbaseID:XB-GENE-854851 Length:106 Species:Xenopus tropicalis


Alignment Length:83 Identity:30/83 - (36%)
Similarity:52/83 - (62%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VIKNADMSEEMQQDAVDCATQALEKYNIEKDIAA-YIKKEFDKKYNPTWHCIVGRNFGSYVTHET 70
            :|::.||.|||:.:.::....|.||:....:.|| .||:..|||:..:||.::|..||..:|||.
 Frog    22 LIRHTDMPEEMRVETMELCVTACEKFASNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEV 86

  Fly    71 RHFIY-FYLGQVAILLFK 87
            ::.:| |:.|.:||.::|
 Frog    87 KNLLYMFFGGSLAICVWK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 30/83 (36%)
dnal4NP_001006784.1 Dynein_light 21..104 CDD:366522 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.