DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and CG8407

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001163124.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster


Alignment Length:102 Identity:37/102 - (36%)
Similarity:61/102 - (59%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRKA-------------VIKNADMSEEMQQDAVDCATQALEKYNIEKDIAA-YIKKEFDKKYN 51
            |:|.:|             ::|:.||:|||:.:|::.:..|.|||:...:.|| .||:..|||:.
  Fly     1 MADEEAGKEGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYSSNYEHAAKIIKENMDKKFG 65

  Fly    52 PTWHCIVGRNFGSYVTHETRHFIY-FYLGQVAILLFK 87
            ..||.:||..||..|::||.:.:| |:.|.:||:|:|
  Fly    66 IYWHVVVGEGFGFEVSYETENILYLFFAGNLAIVLWK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 37/102 (36%)
CG8407NP_001163124.1 Dynein_light 18..102 CDD:279552 33/83 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.