DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and dlc-5

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001023571.1 Gene:dlc-5 / 3565343 WormBaseID:WBGene00043067 Length:186 Species:Caenorhabditis elegans


Alignment Length:105 Identity:39/105 - (37%)
Similarity:63/105 - (60%) Gaps:16/105 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET 70
            |.::::.|...|:|:|...|.:::..|::|.|||.::|..||::|.|.||||.|::|||:||.|.
 Worm    58 ADVQHSRMPRHMEQEACSLAAKSIMTYHLEHDIARHLKMAFDREYGPDWHCICGKHFGSFVTFEP 122

  Fly    71 RHFIYFYLGQVAILLFKSGXSIVESDEVVVRRLMEMQQLP 110
            ..||||.:|.:|.:|||:                .:|:||
 Worm   123 DSFIYFRIGTIAFMLFKT----------------SLQRLP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 36/82 (44%)
dlc-5NP_001023571.1 Dynein_light 58..139 CDD:279552 34/80 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.