DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and Cdlc2

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001245836.1 Gene:Cdlc2 / 33319 FlyBaseID:FBgn0026141 Length:89 Species:Drosophila melanogaster


Alignment Length:89 Identity:88/89 - (98%)
Similarity:89/89 - (100%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65
            ||||||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||
  Fly     1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSY 65

  Fly    66 VTHETRHFIYFYLGQVAILLFKSG 89
            ||||||||||||||||||||||||
  Fly    66 VTHETRHFIYFYLGQVAILLFKSG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 86/87 (99%)
Cdlc2NP_001245836.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 81/82 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469151
Domainoid 1 1.000 132 1.000 Domainoid score I1665
eggNOG 1 0.900 - - E1_KOG3430
Homologene 1 1.000 - - H115597
Inparanoid 1 1.050 136 1.000 Inparanoid score I1821
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 1 1.000 - - FOG0001307
OrthoInspector 1 1.000 - - otm26511
orthoMCL 1 0.900 - - OOG6_101264
Panther 1 1.100 - - P PTHR11886
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R360
SonicParanoid 1 1.000 - - X523
1312.830

Return to query results.
Submit another query.