DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and Dnal4

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001009666.1 Gene:Dnal4 / 300078 RGDID:1309099 Length:105 Species:Rattus norvegicus


Alignment Length:83 Identity:29/83 - (34%)
Similarity:52/83 - (62%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VIKNADMSEEMQQDAVDCATQALEKY-NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET 70
            :::::||.|||:.:.::....|.||| |..:..|..||:..|||:..:||.::|..||..:|||.
  Rat    21 LVRHSDMPEEMRVETMELCVTACEKYSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEV 85

  Fly    71 RHFIYFYL-GQVAILLFK 87
            ::.:|.|. |.:|:.::|
  Rat    86 KNLLYLYFGGTLAVCVWK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 29/83 (35%)
Dnal4NP_001009666.1 Dynein_light 20..103 CDD:279552 28/81 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.