DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and AT1G52245

DIOPT Version :10

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001154419.1 Gene:AT1G52245 / 28717345 AraportID:AT1G52245 Length:94 Species:Arabidopsis thaliana


Alignment Length:93 Identity:39/93 - (41%)
Similarity:60/93 - (64%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIE--KDIAAYIKKEFDKKYNPTWHCIVGRNFG 63
            |.:.||:::::||..:||..|:..|:|||:.:::.  |.||.:||||||::|...|.|:||.|||
plant     1 MLEGKAMVEDSDMPVKMQMQAMAFASQALDLFDVFDCKSIAGHIKKEFDERYGSGWQCVVGSNFG 65

  Fly    64 SYVTHETRHFIYFYLGQVAILLFKSGXS 91
            .:.||....||||.|..:..|:||...:
plant    66 CFFTHSKGTFIYFQLETLKFLIFKGAST 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 37/84 (44%)
AT1G52245NP_001154419.1 Dynein_light 5..89 CDD:460119 36/83 (43%)

Return to query results.
Submit another query.