DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and dlc-2

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_502298.2 Gene:dlc-2 / 187460 WormBaseID:WBGene00010888 Length:90 Species:Caenorhabditis elegans


Alignment Length:89 Identity:35/89 - (39%)
Similarity:55/89 - (61%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65
            ||:.|..:|..||.:..:...:....:|...|||:||:||::|:|.|||:..|||.|.|:.|||.
 Worm     1 MSEEKIEVKETDMEDPQRDMVISVVREAQRLYNIDKDVAAFVKEELDKKFGATWHVICGKCFGSR 65

  Fly    66 VTHETRHFIYFYLGQVAILLFKSG 89
            |::|..|||.....:|.::::|.|
 Worm    66 VSYEMGHFILLKCNKVNVMIYKCG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 34/87 (39%)
dlc-2NP_502298.2 Dynein_light 5..87 CDD:279552 31/81 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53822
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.