DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and LOC1270194

DIOPT Version :10

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_308872.2 Gene:LOC1270194 / 1270194 VectorBaseID:AGAMI1_011111 Length:105 Species:Anopheles gambiae


Alignment Length:93 Identity:34/93 - (36%)
Similarity:61/93 - (65%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDRKAV-----IKNADMSEEMQQDAVDCATQALEKYNIEKDIAA-YIKKEFDKKYNPTWHCIVGR 60
            :|:|.|     :|.:||:::::.:|::.:..|.|||....::|| .||:..|||:...||.:||.
Mosquito    11 ADKKIVHVYPLVKYSDMNDDVRAEAIELSITACEKYAQNYEVAAKTIKELMDKKFGTFWHVVVGE 75

  Fly    61 NFGSYVTHETRHFIY-FYLGQVAILLFK 87
            .||..|::||::.:| |:.|.:||:|:|
Mosquito    76 GFGYEVSYETKNILYLFFGGNLAIVLWK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 33/90 (37%)
LOC1270194XP_308872.2 DLC-like_DNAL4 21..103 CDD:412001 30/81 (37%)

Return to query results.
Submit another query.