DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and dynll2

DIOPT Version :9

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001165079.1 Gene:dynll2 / 100038056 XenbaseID:XB-GENE-854532 Length:89 Species:Xenopus tropicalis


Alignment Length:89 Identity:86/89 - (96%)
Similarity:89/89 - (100%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65
            |||||||||||||||:||||||||||||:||||||||||||||||||||||||||||||||||||
 Frog     1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65

  Fly    66 VTHETRHFIYFYLGQVAILLFKSG 89
            |||||:||||||||||||||||||
 Frog    66 VTHETKHFIYFYLGQVAILLFKSG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 PTZ00059 1..89 CDD:185421 84/87 (97%)
dynll2NP_001165079.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 79/82 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115597
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53822
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11886
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R360
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.