DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctp and dnal4b

DIOPT Version :10

Sequence 1:NP_001356933.1 Gene:ctp / 31405 FlyBaseID:FBgn0011760 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001018338.1 Gene:dnal4b / 100005529 ZFINID:ZDB-GENE-050208-510 Length:106 Species:Danio rerio


Alignment Length:83 Identity:29/83 - (34%)
Similarity:52/83 - (62%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VIKNADMSEEMQQDAVDCATQALEKYNIEKDIAA-YIKKEFDKKYNPTWHCIVGRNFGSYVTHET 70
            :|::.||.|||:.:.::....|.||:....:.|| .||:..|||:..:||.::|..||..:|||.
Zfish    22 LIRHTDMPEEMRVETMELCVTACEKFATNNESAAKMIKESMDKKFGSSWHVVIGEGFGFEITHEV 86

  Fly    71 RHFIY-FYLGQVAILLFK 87
            ::.:| |:.|.:|:.::|
Zfish    87 KNLLYMFFGGSLAVCVWK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctpNP_001356933.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 29/83 (35%)
dnal4bNP_001018338.1 DLC-like_DNAL4 22..104 CDD:412001 28/81 (35%)

Return to query results.
Submit another query.