DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and PTC1

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_010278.3 Gene:PTC1 / 851558 SGDID:S000002164 Length:281 Species:Saccharomyces cerevisiae


Alignment Length:319 Identity:83/319 - (26%)
Similarity:138/319 - (43%) Gaps:87/319 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 RKYMEDQFSVAYQESPITHELEYAFFGIYDGHGGPEAALFAKEHLMLEIVKQKQFWSDQDEDVLR 331
            |:.|||..:  |.:: ....|::.:|.::|||.|.:|:.:..:|  |..:.::...:|:..||..
Yeast    32 RRTMEDVHT--YVKN-FASRLDWGYFAVFDGHAGIQASKWCGKH--LHTIIEQNILADETRDVRD 91

  Fly   332 AIREGYIATHFAMWREQEKWPRTANGHL-STAGTTATVAFMRRE-----------------KIYI 378
            .:.:.::|.      ::|     .|..| ..:|.||.|..:|.|                 |:|.
Yeast    92 VLNDSFLAI------DEE-----INTKLVGNSGCTAAVCVLRWELPDSVSDDSMDLAQHQRKLYT 145

  Fly   379 GHVGDSGIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIKSGVPRVVWNRPRDPM 443
            .:||||.|||      .||..:..||.|||.....|..|::::|| :.:||.|..:         
Yeast   146 ANVGDSRIVL------FRNGNSIRLTYDHKASDTLEMQRVEQAGG-LIMKSRVNGM--------- 194

  Fly   444 HRGPIRRRTLVDEIPFLAVARSLGDLWSYNSRFKEFVVSPDPDVKVVKINPSTFRCLIFGTDGLW 508
                            |||.|||||      :|.:.:|...|....|:|. |..:.||...||||
Yeast   195 ----------------LAVTRSLGD------KFFDSLVVGSPFTTSVEIT-SEDKFLILACDGLW 236

  Fly   509 NVVTAQEAVDSVRKEHLIGEILNEQDVMNPSKALVDQALKTWAAKKMRADNTSVVTVIL 567
            :|:..|:|.:.::            |:..|::|.  :.|..:|.:....||.:|:.|.|
Yeast   237 DVIDDQDACELIK------------DITEPNEAA--KVLVRYALENGTTDNVTVMVVFL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 82/317 (26%)
PTC1NP_010278.3 PP2Cc 12..279 CDD:214625 81/315 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.