DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and AT5G26010

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_197973.2 Gene:AT5G26010 / 832670 AraportID:AT5G26010 Length:331 Species:Arabidopsis thaliana


Alignment Length:366 Identity:87/366 - (23%)
Similarity:148/366 - (40%) Gaps:77/366 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 SSSSNSNSSSSSATGSSASTGNPSPCSSLGVNM-----RVTGQCCQGGRKYMEDQFSVAYQESPI 283
            ||.|..:..:....|:....|     ...|::.     |:...|...|.|.:....:|.||... 
plant     9 SSQSEIHEDNEHGDGNVVCYG-----EEFGLDQDLPVHRLGSVCSIQGTKVLNQDHAVLYQGYG- 67

  Fly   284 THELEYAFFGIYDGHGGPEAALFAKEHLMLEIVKQKQFWSDQDEDVLRAIREGYIATHFAMWREQ 348
            |.:.|..  |::||||       ...|::.::|:.:.      ..||.|::|...........|.
plant    68 TRDTELC--GVFDGHG-------KNGHMVSKMVRNRL------PSVLLALKEELNQESNVCEEEA 117

  Fly   349 EKWPRTANG--------------HLSTAGTTATVAFMRREKIYIGHVGDSGIVLGYQNK-GERNW 398
            .||.:....              :.|.:|:|..||..:.:.:.|.::|||..|||...: ||  .
plant   118 SKWEKACFTAFRLIDRELNLQVFNCSFSGSTGVVAITQGDDLVIANLGDSRAVLGTMTEDGE--I 180

  Fly   399 RARPLTTDHKPESLAEKTRIQRSGGNV-AIKSGVPRVVWNRPRDPMHRGPIRRRTLV--DEIPFL 460
            :|..||:|..|:..:|..||:...|.| |:|:                .|..:|..:  ..||.|
plant   181 KAVQLTSDLTPDVPSEAERIRMCKGRVFAMKT----------------EPSSQRVWLPNQNIPGL 229

  Fly   461 AVARSLGDLWSYNSRFKEFVVSPDPDVKVVKINPSTFRCLIFGTDGLWNVVTAQEAVDSVRKEHL 525
            |::|:.||.     |.|:..|...|::...:|. |..:.|:..|||:|::::..|.|.      |
plant   230 AMSRAFGDF-----RLKDHGVIAVPEISQHRIT-SKDQFLVLATDGVWDMLSNDEVVS------L 282

  Fly   526 IGEILNEQDVMNPSKALVDQALKTWAAKKMRADNTSVVTVI 566
            |.....:|  .:.:|.:.:.|...| .|:::......:|||
plant   283 IWSSGKKQ--ASAAKMVAEAAEAAW-KKRLKYTKVDDITVI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 81/334 (24%)
AT5G26010NP_197973.2 PP2Cc 42..324 CDD:238083 81/328 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.