DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and AT4G32950

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_195021.1 Gene:AT4G32950 / 829432 AraportID:AT4G32950 Length:326 Species:Arabidopsis thaliana


Alignment Length:311 Identity:80/311 - (25%)
Similarity:128/311 - (41%) Gaps:72/311 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 QESPITHELEY-----AFFGIYDGHGGPEAALFAKEHLMLEIVKQKQFWSDQDEDVLRAIREGYI 338
            |::.|.| |.|     |..|::||| ||..|..:|.      |:.:          |.:|..|::
plant    56 QDAAILH-LGYGTEEGALCGVFDGH-GPRGAFVSKN------VRNQ----------LPSILLGHM 102

  Fly   339 ATHFAM--WR--------EQEK-WPRTANGH-LSTAGTTATVAFMRREKIYIGHVGDS-GIVLGY 390
            ..|...  |:        |.:| ..:....| .|.:||||.:|.....::.:.::||| .:::|.
plant   103 NNHSVTRDWKLICETSCLEMDKRILKVKKIHDCSASGTTAVLAVKHGNQVMVANLGDSRAVMIGT 167

  Fly   391 QNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIKSGVPRV--VWNRPRDPMHRGPIRRRTL 453
            ...||.  :...||.|.||...:|..||::..|.|......|.:  ||.         |...|  
plant   168 SEDGET--KVAQLTNDLKPSVPSEAERIRKRNGRVLALESEPHILRVWL---------PTENR-- 219

  Fly   454 VDEIPFLAVARSLGDLWSYNSRFKEFVVSPDPDVKVVKINPSTFRCLIFGTDGLWNVVTAQEAVD 518
                |.||::|:.||.     ..|.:.|...|.|...:|. |:.:.|:..:||:|:|::.:|...
plant   220 ----PGLAMSRAFGDF-----LLKSYGVIATPQVSTHQIT-SSDQFLLLASDGVWDVLSNEEVAT 274

  Fly   519 SVRKEHLIGEILNEQDVMNPSKALVDQALKTWAAK--KMRADNTSVVTVIL 567
            .|.|........||         :.:.|...|..|  .::.|:.|||.:.|
plant   275 VVMKSASEAGAANE---------VAEAATNAWIQKFPTVKIDDISVVCLSL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 79/309 (26%)
AT4G32950NP_195021.1 PP2Cc 43..316 CDD:238083 79/309 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.