DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and AT4G28400

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_567808.1 Gene:AT4G28400 / 828957 AraportID:AT4G28400 Length:283 Species:Arabidopsis thaliana


Alignment Length:328 Identity:88/328 - (26%)
Similarity:150/328 - (45%) Gaps:68/328 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 GSSASTGNPSPCSSLGVNMRVTGQCCQGGRKYMEDQFSVAYQESPITHELEYAFFGIYDGHGGPE 302
            ||:...|...  |.:..|:.....|.:|...:..:.:.|:..:....|||  ..|.|:|||.|.:
plant    18 GSAPDMGRGK--SKMWKNITHGFHCVKGKSSHPMEDYVVSEFKKLEGHEL--GLFAIFDGHLGHD 78

  Fly   303 AALFAKEHLMLEIVKQKQFWSDQDEDVLRAIREGYIATHFAMWREQEKWPRTANGHLSTAGTTA- 366
            .|.:.:.:|...|:|:|.||:|.:    .|||..|.:|...:.::..|        |...|:|| 
plant    79 VAKYLQTNLFDNILKEKDFWTDTE----NAIRNAYRSTDAVILQQSLK--------LGKGGSTAV 131

  Fly   367 TVAFMRREKIYIGHVGDSGIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVA-IKSG 430
            |...:..:|:.:.:||||..|:      .:|..|..|:.||:|..  ||..|:..||.|: |...
plant   132 TGILIDGKKLVVANVGDSRAVM------SKNGVAHQLSVDHEPSK--EKKEIESRGGFVSNIPGD 188

  Fly   431 VPRVVWNRPRDPMHRGPIRRRTLVDEIPFLAVARSLGDLWSYNSRFKEFVVSPDPDVKVVKINPS 495
            ||||...                      |||||:.||      :..:..:|.:||:....|:..
plant   189 VPRVDGQ----------------------LAVARAFGD------KSLKLHLSSEPDITHQTIDDH 225

  Fly   496 TFRCLIFGTDGLWNVVTAQEAVDSVRKEHLIGEILNEQDVMNPSKALVDQALKTWAAKKMRADNT 560
            | ..::|.:||:|.|::.|||||:::         :.:|....:|.|:::|:    ::|.:.|.:
plant   226 T-EFILFASDGIWKVLSNQEAVDAIK---------SIKDPHAAAKHLIEEAI----SRKSKDDIS 276

  Fly   561 SVV 563
            .:|
plant   277 CIV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 83/310 (27%)
AT4G28400NP_567808.1 PP2Cc 36..282 CDD:238083 83/308 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.