DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and AT3G23360

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_188978.2 Gene:AT3G23360 / 821917 AraportID:AT3G23360 Length:260 Species:Arabidopsis thaliana


Alignment Length:294 Identity:63/294 - (21%)
Similarity:105/294 - (35%) Gaps:95/294 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 SVAYQESPITHELEYAFFGIYDGHGGPEAALFAKEHLMLEIVKQKQFWSDQDEDVLRAIREGYIA 339
            ||..|....:.|||...||:.:...|.|...:.:.||..::..:........|.:.||    |: 
plant    58 SVFVQREQQSDELEIWLFGVSNAGTGKEIVKYMQNHLFDKLPNELGIMRKCKETMRRA----YV- 117

  Fly   340 THFAMWREQEKWPRTANGHLSTAGTTATVAFMRREKIYIGHVGDSGIVLGYQNKGERNW-RARPL 403
                   |:|:          |.|:.|:|..:..||:.|..:||..:|:  ...||.:. |.|..
plant   118 -------EEER----------TGGSAASVMVVNGEKLAIASIGDHRVVV--CKDGEAHQIRDRKA 163

  Fly   404 TTDHKPESLAEKTRIQRSGGNVAIKSGVPRVVWNRPRDPMHRGPIRRRTLVDEIPFLAVARSLGD 468
            :|.|..:.:..                    |.|:..:.....|                     
plant   164 STKHWSQFIFP--------------------VCNQGEEEDESDP--------------------- 187

  Fly   469 LWSYNSRFKEFVVSPDPDVKVVKINPSTFRCLIFGTDGLWNVVTAQEAVDSVRKEHLIGEILNEQ 533
                  |..|.||..:      |||..| ..:|.|:.|:|.|:.:|||::.:|  |:       :
plant   188 ------RNSELVVITE------KINSDT-EFIIIGSPGIWEVMKSQEAINLIR--HI-------E 230

  Fly   534 DVMNPSKALVDQALKTWAAKKMRADNTSVVTVIL 567
            |....:|.|..:||.       |...:|:..|::
plant   231 DPKEAAKCLAKEALN-------RISKSSISCVVI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 63/292 (22%)
AT3G23360NP_188978.2 PP2Cc 52..257 CDD:214625 63/292 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.