DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and AT3G16800

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_001319572.1 Gene:AT3G16800 / 820933 AraportID:AT3G16800 Length:351 Species:Arabidopsis thaliana


Alignment Length:385 Identity:96/385 - (24%)
Similarity:152/385 - (39%) Gaps:87/385 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 RSIPESCASSSNSNSSSSSNSNSSSSSATGSSASTGNPSPCSSLGVNMRVTGQCCQGGRKYMEDQ 273
            |.|.:|....|..||:....|...||.:                  :.|.|..|...|.|.:...
plant    31 REIAKSMIKDSKKNSTLLGTSGFVSSES------------------SKRFTSICSNRGEKGINQD 77

  Fly   274 FSVAYQ----ESPITHELEYAFFGIYDGHGGPEAALFAKEHLMLEIVKQKQFWSD---QDEDVLR 331
            .::.::    :..||      |.|::||| ||...:.||.      || |.|.|.   |.:..|.
plant    78 RAIVWEGFGCQEDIT------FCGMFDGH-GPWGHVIAKR------VK-KSFPSSLLCQWQQTLA 128

  Fly   332 AIREG-YIATHFAMWRE-----------QEKWPRTANGHLSTAGTTATVAFMRREKIYIGHVGDS 384
            ::... ..::.|.:|::           ..|...:.:.:.|  |.||..|.::.:.:.|.:.|||
plant   129 SLSSSPECSSPFDLWKQACLKTFSIIDLDLKISPSIDSYCS--GCTALTAVLQGDHLVIANAGDS 191

  Fly   385 GIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIKSGVPRVVWNRPRDPMHRGPIR 449
            ..|:...:..........|:.|.||....|..||::|.|.:......|.|.    |..|..|...
plant   192 RAVIATTSDDGNGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDEPGVY----RVGMPNGGSL 252

  Fly   450 RRTLVDEIPFLAVARSLGDLWSYNSRFKEFVVSPDPDVKVVKINPSTFRCLIFGTDGLWNVVTAQ 514
            .         |||:|:.||..     .|:|.:..:|:|...||.... :.||..|||:|:|:|..
plant   253 G---------LAVSRAFGDYC-----LKDFGLVSEPEVTYRKITDKD-QFLILATDGMWDVMTNN 302

  Fly   515 EAVDSVR--KEHLIGEILNEQDVMNPSKALVDQALKTWAAKK--MRADNTSVVTVILTPA 570
            |||:.||  ||.           ...:|.||::|:..|..|:  :..|:.||:.:...|:
plant   303 EAVEIVRGVKER-----------RKSAKRLVERAVTLWRRKRRSIAMDDISVLCLFFRPS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 86/333 (26%)
AT3G16800NP_001319572.1 PP2Cc 61..348 CDD:238083 86/332 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.