DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and AT3G05640

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_001326841.1 Gene:AT3G05640 / 819731 AraportID:AT3G05640 Length:358 Species:Arabidopsis thaliana


Alignment Length:445 Identity:109/445 - (24%)
Similarity:166/445 - (37%) Gaps:139/445 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 AKPLNPKKQRLNSATTTTINRSRGGGAAQSRLRRSAAIVPPRSIPESCASSSNSNSSSSSNSNSS 232
            ||.:|..|.....||.   ..:|.....:..||.|..|                 ::..||:.:|
plant    20 AKNINSSKSYAKEATD---EMAREAKKKELILRSSGCI-----------------NADGSNNLAS 64

  Fly   233 SSSATGSSASTGNPSPCSSLGVNMRVT----GQCCQGGRKYMEDQFSVAYQESPITHELEYAFFG 293
            ..|..|..            |||....    |..||      ||..                |.|
plant    65 VFSRRGEK------------GVNQDCAIVWEGYGCQ------EDMI----------------FCG 95

  Fly   294 IYDGHGGPEAALFAKE-------HLML---EIVKQKQFWSDQDEDVLRAIREGYIATHFAMWR-- 346
            |:||| ||.....:|:       .|:.   |.:.|... ::.|:::.|          ||:|:  
plant    96 IFDGH-GPWGHFVSKQVRNSMPISLLCNWKETLSQTTI-AEPDKELQR----------FAIWKYS 148

  Fly   347 ------------EQEKWPRTANGHLSTAGTTATVAFMRREKIYIGHVGDSGIVLGYQNKGERNWR 399
                        |..:...:.|     :||||.....:.:.|||.:||||..||...: .|.:..
plant   149 FLKTCEAVDLELEHHRKIDSFN-----SGTTALTIVRQGDVIYIANVGDSRAVLATVS-DEGSLV 207

  Fly   400 ARPLTTDHKPESLAEKTRIQRSGGNVAIKSGVPRV--VWNRPRDPMHRGPIRRRTLVDEIPFLAV 462
            |..||.|.||....|:.||....|.|......|.|  || :|              |||.|.||:
plant   208 AVQLTVDFKPNLPQEEERIIGCNGRVFCLQDEPGVHRVW-QP--------------VDESPGLAM 257

  Fly   463 ARSLGDLWSYNSRFKEFVVSPDPDVKVVKINPSTFRCLIFGTDGLWNVVTAQEAVDSVRKEHLIG 527
            :|:.||   |..:....|..|:...:.:.|..   :.:|..|||:|:|::.|||:|.|.      
plant   258 SRAFGD---YCIKDYGLVSVPEVTQRHISIRD---QFIILATDGVWDVISNQEAIDIVS------ 310

  Fly   528 EILNEQDVMNPSKALVDQALKTWAAKK--MRADNTSVVTVILTPAARNNSPTTPT 580
               :..:....:|.||.||::.|..|:  :..|:.|.|.:..     ::|.::|:
plant   311 ---STAERAKAAKRLVQQAVRAWNRKRRGIAMDDISAVCLFF-----HSSSSSPS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 88/342 (26%)
AT3G05640NP_001326841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.