DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and AT2G34740

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_181021.4 Gene:AT2G34740 / 818039 AraportID:AT2G34740 Length:339 Species:Arabidopsis thaliana


Alignment Length:314 Identity:87/314 - (27%)
Similarity:140/314 - (44%) Gaps:75/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 VTGQCCQGGRKYMEDQFSVAYQESPITHELEYAFFGIYDGHGGPEAALFAKEHLMLEIVKQKQFW 322
            |.||...|    ||| |.||..::...|.|  ..:.|:|||.|.:.|.:.:.||...|:.|..||
plant    93 VKGQMGHG----MED-FIVADTKTVKGHNL--GLYAIFDGHSGSDVADYLQNHLFDNILSQPDFW 150

  Fly   323 SDQDEDVLRAIR--EGYIATHFAMWREQEKWPRTANGHLSTAGTTATVAF-MRREKIYIGHVGDS 384
            .:..:.:.||.:  :.||..:..       .||        .|:||..|. :..:||.:.:||||
plant   151 RNPKKAIKRAYKSTDDYILQNVV-------GPR--------GGSTAVTAIVIDGKKIVVANVGDS 200

  Fly   385 GIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIKSG-VPRVVWNRPRDPMHRGPI 448
            ..:|..::.     ..:.:|.||:|:.  |:..::..||.|:.|.| ||||...           
plant   201 RAILCRESD-----VVKQITVDHEPDK--ERDLVKSKGGFVSQKPGNVPRVDGQ----------- 247

  Fly   449 RRRTLVDEIPFLAVARSLGDLWSYNSRFKEFVVSPDPDVKVVKINPSTFRCLIFGTDGLWNVVTA 513
                       ||:.|:.||     ...||. :|..|::::.:|:..| :.||..:||||.|::.
plant   248 -----------LAMTRAFGD-----GGLKEH-ISVIPNIEIAEIHDDT-KFLILASDGLWKVMSN 294

  Fly   514 QEAVDSVRKEHLIGEILNEQDVMNPSKALVDQALKTWAAKKMRADNTSVVTVIL 567
            .|..|.::|..      |.::.   :|.|:|:||    |:..:.|.:.||...|
plant   295 DEVWDQIKKRG------NAEEA---AKMLIDKAL----ARGSKDDISCVVVSFL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 86/312 (28%)
AT2G34740NP_181021.4 PP2Cc 86..334 CDD:238083 86/311 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.