DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and ppm1lb

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_001307112.1 Gene:ppm1lb / 767640 ZFINID:ZDB-GENE-060929-136 Length:348 Species:Danio rerio


Alignment Length:320 Identity:98/320 - (30%)
Similarity:150/320 - (46%) Gaps:71/320 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 QGGRKYMEDQFSVAYQESPITHELEYAFFGIYDGHGGPEAALFAKEHLMLEIVKQKQFWSDQDED 328
            ||.|.:|||:|.:.......:|.   |.|.|||||||..||.:||.||.:.:.:|.|.:..|   
Zfish    88 QGRRDHMEDRFDILTDTRNRSHP---AIFSIYDGHGGEAAAEYAKAHLPIMLRQQLQRYERQ--- 146

  Fly   329 VLRAIREGYIATHFAMWREQ---------EKWPRTANGHLSTAGTTATVAFMRREKIYIGHVGDS 384
                 :|....:..|:.|:|         ||  .||:  ...||||..||.:..:::.:.:||||
Zfish   147 -----KENSAVSRQAILRQQILNMDREILEK--LTAS--YDEAGTTCLVALLSEKELTVANVGDS 202

  Fly   385 GIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIKSGVPRVVWNRPRDPMHRGPIR 449
            ..||     .:::..|.||:.||||..|.|:.||:::||.::. ||..||          :|   
Zfish   203 RAVL-----CDKDGNAIPLSHDHKPYQLKERKRIKKAGGFISF-SGSWRV----------QG--- 248

  Fly   450 RRTLVDEIPFLAVARSLGDLWSYNSRFKEF-VVSPDPDVKVVKINPSTFRCLIFGTDGLWNVVTA 513
                     .|:::|||||.     ..|:. |:.||||:....::....:.:|..:||||:..:.
Zfish   249 ---------VLSMSRSLGDF-----PLKKLKVLIPDPDLMTFDLDTLQPQFMILASDGLWDTFSN 299

  Fly   514 QEAVDSVRKEHLIGEILNEQDVMNPSKALVDQALKTWAAKKMRADNTSVVTVILTPAARN 573
            :|||      |.|.|.|:|...  .:|::|.|:.....     .||.:|:.|.....|.|
Zfish   300 EEAV------HFIKERLDEPHF--GAKSIVLQSFYRGC-----PDNITVMVVKFKKRAGN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 96/312 (31%)
ppm1lbNP_001307112.1 PP2Cc 82..340 CDD:238083 96/312 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.