DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and pptc7b

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:XP_009303413.1 Gene:pptc7b / 562909 ZFINID:ZDB-GENE-081105-111 Length:297 Species:Danio rerio


Alignment Length:356 Identity:64/356 - (17%)
Similarity:111/356 - (31%) Gaps:134/356 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 VTGQCCQG----------GRKYMEDQFSVAYQESPITHELEYAFFGIYDGHG-----GPEAALFA 307
            :|..|..|          |..|.:|...:|..:|.       ...|:.||.|     |.:.:.|:
Zfish    30 ITASCGFGKDFRKGILKKGMCYGDDACFIARHKSA-------DVLGVADGVGGWRDYGVDPSQFS 87

  Fly   308 KEHLML--EIVKQKQFWSDQDEDVLRAIREGYIATHFAMWREQEKWPRTANGHLSTAGTTATVAF 370
            ...:..  .:||:.:|.......:|.:   ||...      .|.|.|      |..:.|...|..
Zfish    88 ATLMKTCERLVKEGRFTPSSPVGILTS---GYYEL------LQNKVP------LLGSSTACIVVL 137

  Fly   371 MRR-EKIYIGHVGDSGIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIKSGVPRV 434
            .|| .:|:..::||||.::                               ..||.|..:|...:.
Zfish   138 DRRSHRIHTCNLGDSGFLV-------------------------------VRGGEVVHRSDEQQH 171

  Fly   435 VWNRPRDPMHRGPIRRRTLVDEIPFLAVARS----LGDLWSYNSRFKEFVVSPDPDVKVVKINPS 495
            .:|.|.......|.....::.:.|..|.:.|    |||:                          
Zfish   172 YFNTPFQLSIAPPGAEGVVLSDSPEAADSSSFDVQLGDI-------------------------- 210

  Fly   496 TFRCLIFGTDGLW------------------NVVTAQEAVDSVRKE-HLIGEILNEQDVMNP-SK 540
                ::..||||:                  |..:.|:...|:.:: |   |:..:.:.|:| ::
Zfish   211 ----ILTATDGLFDNMPDYMILQELKKLKNTNYDSIQQTARSIAEQAH---ELAYDPNYMSPFAQ 268

  Fly   541 ALVDQALKTWAAKKMRADNTSVVTVILTPAA 571
            ...|..|      .:|......:||:|:..|
Zfish   269 FACDNGL------NVRGGKPDDITVLLSIVA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 62/350 (18%)
pptc7bXP_009303413.1 PP2Cc 53..289 CDD:294085 57/327 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.