DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and alph

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster


Alignment Length:367 Identity:99/367 - (26%)
Similarity:162/367 - (44%) Gaps:83/367 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 QGGRKYMEDQFSVAYQESPITHEL-EYAFFGIYDGHGGPEAALFAKEHLMLEIVKQKQFWSDQDE 327
            ||.|..|||.:   |..:.:...| :::||.::|||.|.:.:....:||:..|:..::|...   
  Fly    30 QGWRSEMEDAY---YARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGG--- 88

  Fly   328 DVLRAIREGYIATHFAMWREQEKWPRTANGHLSTAGTTATVAFMRREKIYIGHVGDSGIVLGYQN 392
            |.::.||.|::.....| ||..::.|.:.   ...||||..||:...::||.:.|||..||..|.
  Fly    89 DHVKGIRTGFLRIDEVM-RELPEFTRESE---KCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQG 149

  Fly   393 KGERNWRARPL--TTDHKPESLAEKTRIQRSGGNVAIK--SGVPRVVWNRPRDPMHRGPIRRRTL 453
            .        |:  |.||||....||.||..:||:|.||  :|.                      
  Fly   150 V--------PVFATQDHKPILPEEKERIYNAGGSVMIKRVNGT---------------------- 184

  Fly   454 VDEIPFLAVARSLGDLWSYNSRFK---EFVVSPDPDVKVVKINPSTFRCLIFGTDGLWNVVTAQE 515
                  |||:|:|||....|.:.|   |.:|||:|:: ..:....:...|:...||:|:|::   
  Fly   185 ------LAVSRALGDYDFKNVKEKGQCEQLVSPEPEI-FCQSRQDSDEFLVLACDGIWDVMS--- 239

  Fly   516 AVDSVRKEHLIGEILNEQDVMNPSKALVDQALKTWAAKKMRADNTSVVTVILTPAARNNSPTTPT 580
                  .|.:...|.:...|.:...::.:|.:.|...|..| ||.|:: :|..|.|     ..||
  Fly   240 ------NEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSR-DNMSII-IIAFPGA-----PKPT 291

  Fly   581 RSPSAMARDNDLEVELLLEEDDEELPTLDVEN----NYPDFL 618
                    :..:|.|..||:..|::...::|:    :|.|.|
  Fly   292 --------EEAIEAEHRLEKQIEKITRDEIESSKITDYVDLL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 85/310 (27%)
alphNP_651701.1 PP2Cc 24..284 CDD:238083 86/311 (28%)
PP2C_C 278..352 CDD:285117 15/62 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445118
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47992
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.