DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and Pdp2

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_001019777.1 Gene:Pdp2 / 382051 MGIID:1918878 Length:532 Species:Mus musculus


Alignment Length:402 Identity:80/402 - (19%)
Similarity:134/402 - (33%) Gaps:129/402 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 FGIYDGHGGPEAALFAKEHL---MLEIVKQKQFWSDQDE---------DVLR-------AIREGY 337
            |||:|||||...|....|.|   |...:...|.....:|         .:||       :|.:..
Mouse   140 FGIFDGHGGHACAQAVSERLFYYMAVSLMSHQTLEQMEEATENMKPLLPILRWLKHPGDSIYKDV 204

  Fly   338 IATHF----AMWRE-----------------------------------QEKWPRTANGHLSTAG 363
            .:.|.    ..|:|                                   :::..|..:..::.:|
Mouse   205 TSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSG 269

  Fly   364 TTATVAFMRREKIYIGHVGDSGIVLGYQNKGERN--WRARPLTTDHKPESLAEKTRIQRSGGNVA 426
            .||.:|.:....:::.:.||...:||.|   |.|  |...|||.||...:.||.:|::|.     
Mouse   270 ATACMAHVNGVHLHVANAGDCRAILGVQ---EENGAWSCLPLTCDHNAWNEAELSRLKRE----- 326

  Fly   427 IKSGVPRVVWNRPRDPMHRGPIRRRTLVDE--IPFLAVARSLGDL---WS--------------- 471
                             |.....|..::|:  :..|...|:.||:   ||               
Mouse   327 -----------------HPESEDRTLIIDDRLLGVLMPCRAFGDVQLKWSKELQRNVLARGFDTE 374

  Fly   472 ----YNSRFKEFVVSP----DPDVKVVKINPSTFRCLIFGTDGLWNVVTAQEAVDSVRKEHL--I 526
                |......:...|    .|:|...::.... :.|:..:||||:::..::.|..| ..||  :
Mouse   375 ALNIYQFTPPHYYTPPYLTAKPEVTYHRLRRQD-KFLVLASDGLWDMLGNEDVVRLV-VGHLSKV 437

  Fly   527 GEILNEQDVMNPSKALVDQALKTWAAKKMRADNTSVVTVILTPAARNN--SPTTPTRSPSAMARD 589
            |....:.|....:..|:...|....|..:.|.:.:..|.::..|..:|  ....|.|        
Mouse   438 GRHKPDLDQRPANLGLMQSLLLQRKASGLHAADQNTATHLIRHAIGSNEYGEMEPER-------- 494

  Fly   590 NDLEVELLLEED 601
              |...|.|.||
Mouse   495 --LAAMLTLPED 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 71/364 (20%)
Pdp2NP_001019777.1 PP2Cc 112..520 CDD:238083 80/402 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.