DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and Ppm1

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster


Alignment Length:397 Identity:100/397 - (25%)
Similarity:160/397 - (40%) Gaps:117/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 TGSSASTGNPSPCSSLGVNMRVTGQCCQGGRKYMEDQFS--VAYQESPITHELEYAFFGIYDGHG 299
            |.|...|...:.|.: ..:.||...|.||.|..|||..:  ::..:.|     :.|||.:|||||
  Fly     4 TLSEPVTTKDTACCA-NASYRVGSSCMQGWRVDMEDAHTHILSLPDDP-----QAAFFAVYDGHG 62

  Fly   300 GPEAALFAKEHLMLEIVKQKQFWSDQDEDVLRAIREGYIATHFAMWREQEKWPRTANGHL--STA 362
            |...|.:|.:||...|.|:.::   :|..:..|:::.::.....|.:         ||.|  .||
  Fly    63 GASVAKYAGKHLHKFITKRPEY---RDNSIEVALKKAFLDFDREMLQ---------NGSLDEQTA 115

  Fly   363 GTTATVAFMRREKIYIGHVGD-------SGIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQR 420
            |.||.|..:|..::|..:.||       ||:|             ..|:.||||....|..||..
  Fly   116 GCTAIVVLIRERRLYCANAGDSRAIACISGMV-------------HALSVDHKPNDAKESKRIMA 167

  Fly   421 SGGNVAIKSGVPRVVWNRPRDPMHRGPIRRRTLVDEIPFLAVARSLGDLWSYNSRFK---EFVVS 482
            |||.|...    ||..|                      ||::|:|||.....:..|   |.:|:
  Fly   168 SGGWVEFN----RVNGN----------------------LALSRALGDFIYKKNLLKTPEEQIVT 206

  Fly   483 PDPDVKVVKINPSTFRCLIFGTDGLWNVVTAQEAVDSVRK--------EHLIGEILNEQDVMNP- 538
            ..|||:|:.|. .....::...||:|:|::..|....|.|        |.:..|::|  ..::| 
  Fly   207 AYPDVEVLDIT-EDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEPELICEELMN--SCLSPD 268

  Fly   539 --------------------SKALVDQALKTWAAKKMRADNTSVVTV---------ILTPAARNN 574
                                :|:..|.|::....:|     |.|.||         ::||.::.:
  Fly   269 GHTGNVGGDNMTVILVCLLHNKSYEDLAVRCGGKRK-----TPVETVGDIQDQSVKVVTPCSQGS 328

  Fly   575 SPTTPTR 581
            |.::.:|
  Fly   329 SGSSTSR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 92/362 (25%)
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 84/322 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.