DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and Pdp

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster


Alignment Length:316 Identity:64/316 - (20%)
Similarity:115/316 - (36%) Gaps:97/316 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 GIYDGHGGPEAALFAKEHLMLEI--------VKQKQFWSDQDE-----------DVLRAIREGYI 338
            ||:|||.|........:.|:..:        |.::|.....|.           |.:..|:..|.
  Fly    90 GIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYE 154

  Fly   339 ATHFAMWREQEKWP-----------------------------RTANGHLSTAGTTATVAFMRRE 374
            |:......:..:.|                             ||.|..||  |..|.:..:...
  Fly   155 ASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMNVALS--GAVACLVHIEGL 217

  Fly   375 KIYIGHVGDSGIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIKSGVPRVVWNRP 439
            ::::...||.|.|||..:...:.|.::.|..:|..::::|                |.|::...|
  Fly   218 QMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSE----------------VRRILAEHP 266

  Fly   440 RDPMHRGPIRRRTLVDEIPFLAVARSLGDL---WSYN-------SRFKEFVVSPD---------- 484
            ::. |...||...|:.:   ||..|:.||.   ||..       ..|....::|:          
  Fly   267 KEE-HETVIRNGRLLSQ---LAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTAR 327

  Fly   485 PDVKVVKINPSTFRCLIFGTDGLWNVVTAQEAVDSVRKEHLIGEILNEQDVMNPSK 540
            |||:..::.|:. :.|:..:||||:.:...|.|.      |:||.:|.:.::.|.:
  Fly   328 PDVQQHELGPND-KFLVIASDGLWDFLPPSEVVS------LVGEHINSKKILEPMR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 64/316 (20%)
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 64/316 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445127
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.