DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and Ppm1l

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_001101151.1 Gene:Ppm1l / 310506 RGDID:1305220 Length:360 Species:Rattus norvegicus


Alignment Length:325 Identity:98/325 - (30%)
Similarity:148/325 - (45%) Gaps:77/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 QGGRKYMEDQFSVAYQESPITHELEYAFFGIYDGHGGPEAALFAKEHLMLEIVKQKQFWSDQDED 328
            ||.|.:|||:|.|....:..||.   :.|||:|||||..||.:.|..|...:   ||...|.::|
  Rat    99 QGRRDHMEDRFEVLTDLANKTHP---SIFGIFDGHGGETAAEYVKSRLPEAL---KQHLQDYEKD 157

  Fly   329 VLRAIREGYIATHFAMWREQ---------EKWPRTANGHLSTAGTTATVAFMRREKIYIGHVGDS 384
                 :|..:.|:..:..:|         ||    .......||||..:|.:..:.:.:.:||||
  Rat   158 -----KENSVLTYQTILEQQILSIDREMLEK----LTVSYDEAGTTCLIALLSDKDLTVANVGDS 213

  Fly   385 GIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIKSGVPRVVWNRPRDPMHRGPIR 449
            ..||     .:::..|.||:.||||..|.|:.||:|:||.::. :|..||          :|   
  Rat   214 RGVL-----CDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISF-NGSWRV----------QG--- 259

  Fly   450 RRTLVDEIPFLAVARSLGD--LWSYNSRFKEFVVSPDPDVKVVKINPSTFRCLIFGTDGLWNVVT 512
                     .||::|||||  |.:.|      ||.||||:....::......:|..:||||:..:
  Rat   260 ---------ILAMSRSLGDYPLKNLN------VVIPDPDILTFDLDKLQPEFMILASDGLWDAFS 309

  Fly   513 AQEAVDSVRKEHLIGEILNEQDVMNPSKALVDQALKTWAAKKMRADNTSVVTVILTPAARNNSPT 577
            .:|||      ..|.|.|:|...  .:|::|.|:.....     .||.:|:.|    ..||:|.|
  Rat   310 NEEAV------RFIKERLDEPHF--GAKSIVLQSFYRGC-----PDNITVMVV----KFRNSSKT 357

  Fly   578  577
              Rat   358  357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 94/313 (30%)
Ppm1lNP_001101151.1 PP2Cc 93..351 CDD:238083 94/317 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.