DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and Pptc7

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_001100611.1 Gene:Pptc7 / 304488 RGDID:1310383 Length:307 Species:Rattus norvegicus


Alignment Length:304 Identity:62/304 - (20%)
Similarity:98/304 - (32%) Gaps:97/304 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1102 AIVAYGD--STETVGGTAGASGTPAAGRVGGGGGGGGG---------------------RGSASG 1143
            ::::||.  :...:||.:...     .|.|||||||.|                     :|:..|
  Rat     3 SVLSYGRLVARAVLGGLSQTD-----PRAGGGGGGGSGDYGLVTAGCGFGKDFRKGLLKKGACYG 62

  Fly  1144 GSSPAVAANSRRSVNVVANASGNSASK---VVPSSSSMMMTRRSHTLTASG--------GVNKRQ 1197
            ..:..||.:  ||.:|:..|.|....:   |.||..|..:.|....|...|        |:    
  Rat    63 DDACFVARH--RSADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPVGI---- 121

  Fly  1198 LRSSLCTLGLG----VGVGVGLGMDLDMTKRTLRTRNVP-----ALSGGSATPSSN--------- 1244
            |.:|.|.|...    :|......:.||.:...|.|.|:.     .:.||.....|:         
  Rat   122 LTTSYCELLQNKVPLLGSSTACIVVLDRSSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTP 186

  Fly  1245 -----SSPASGG----SSP-----AGFTSPASPVITSRGSG------SRTTASPARRLKRSHEDR 1289
                 :.|.:.|    .||     ..|......:|.:...|      ........::||.|:.:.
  Rat   187 FQLSIAPPEAEGVVLSDSPDAADSTSFDVQLGDIILTATDGLFDNMPDYMILQELKKLKNSNYES 251

  Fly  1290 EQRMSLR--------------RSTLSGSASGSGLVGTGGSPSNV 1319
            .||.:..              .|..:..|..:||...||.|.::
  Rat   252 IQRTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083
Pptc7NP_001100611.1 PP2Cc 63..299 CDD:412173 47/239 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.