DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and fem-2

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_497224.1 Gene:fem-2 / 175217 WormBaseID:WBGene00001412 Length:449 Species:Caenorhabditis elegans


Alignment Length:395 Identity:94/395 - (23%)
Similarity:142/395 - (35%) Gaps:120/395 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 NPSPCSSLG---VNMRVTGQCCQGGRKYMEDQFSVAYQ--------ESPITHELEYAFFGIYDGH 298
            |...|..|.   ..:.|:|...:|.|...||:| :||.        |.||      :...::|||
 Worm   147 NAETCPILSEKWSGIHVSGDQLKGQRHKQEDRF-LAYPNGQYMDRGEDPI------SVLAVFDGH 204

  Fly   299 GGPEAALFAKEHL---MLEIVKQKQFWSDQDEDVLRAIREGYIATHFAMWREQEKWPRTANGHLS 360
            ||.|.:.:|..||   .||:.|.:. .||..||.||...| .:.....:...:|.|         
 Worm   205 GGHECSQYAAGHLWETWLEVRKSRD-PSDSLEDQLRKSLE-LLDERMTVRSVKECW--------- 258

  Fly   361 TAGTTATVAF--MRREKIYIGHVGDS-GIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQRSG 422
            ..|:||....  |.::.:.:..:||| |.|:.       |...|.||..|.|....|..|::.:|
 Worm   259 KGGSTAVCCAIDMDQKLMALAWLGDSPGYVMS-------NIEFRQLTRGHSPSDEREARRVEEAG 316

  Fly   423 GNVAIKSGVPRVVWNRPRDPMHRGPIRRRTLVDEIPFLAVARSLGDLWSYNSRFKEFVVSPDPDV 487
            |.:.:..|..||          .|            .|.:.|:|||:..      ..::|.:|:.
 Worm   317 GQLFVIGGELRV----------NG------------VLNLTRALGDVPG------RPMISNEPET 353

  Fly   488 KVVKINPSTFRCLIFGTDGLWNVVTAQEAVDSVRKEHLIGEILNEQDVMNPSKAL---------- 542
            ..|.|..|.:..|: ..||                   |.::.||:|:....:|.          
 Worm   354 CQVPIESSDYLVLL-ACDG-------------------ISDVFNERDLYQLVEAFANDYPVEDYA 398

  Fly   543 -VDQALKTWAAKKMRADNTSVVTVILTPAARNNSPTTPTRSPSAMARDNDLEVELLLEEDDEELP 606
             :.:.:.|.|.:...|||.|||...|.|                   ..|:...:..|.|||:..
 Worm   399 ELSRFICTKAIEAGSADNVSVVIGFLRP-------------------PQDVWKLMKHESDDEDSD 444

  Fly   607 TLDVE 611
            ..|.|
 Worm   445 VTDEE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 82/335 (24%)
fem-2NP_497224.1 PP2C 161..417 CDD:278884 78/328 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.