DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and PPM1L

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_640338.2 Gene:PPM1L / 151742 HGNCID:16381 Length:360 Species:Homo sapiens


Alignment Length:330 Identity:104/330 - (31%)
Similarity:154/330 - (46%) Gaps:69/330 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 NMRVTGQCCQGGRKYMEDQFSVAYQESPITHELEYAFFGIYDGHGGPEAALFAKEHLMLEIVKQ- 318
            |..|.....||.|.:|||:|.|....:..||.   :.|||:|||||..||.:.|..|. |.:|| 
Human    90 NHNVAVYSIQGRRDHMEDRFEVLTDLANKTHP---SIFGIFDGHGGETAAEYVKSRLP-EALKQH 150

  Fly   319 -KQFWSDQDEDVL--RAIREGYIATHFAMWREQ-EKWPRTANGHLSTAGTTATVAFMRREKIYIG 379
             :.:..|::..||  :.|.|..|   .::.||. ||    .......||||..:|.:..:.:.:.
Human   151 LQDYEKDKENSVLSYQTILEQQI---LSIDREMLEK----LTVSYDEAGTTCLIALLSDKDLTVA 208

  Fly   380 HVGDSGIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIKSGVPRVVWNRPRDPMH 444
            :||||..||     .:::..|.||:.||||..|.|:.||:|:||.::. :|..||          
Human   209 NVGDSRGVL-----CDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISF-NGSWRV---------- 257

  Fly   445 RGPIRRRTLVDEIPFLAVARSLGD--LWSYNSRFKEFVVSPDPDVKVVKINPSTFRCLIFGTDGL 507
            :|            .||::|||||  |.:.|      ||.||||:....::......:|..:|||
Human   258 QG------------ILAMSRSLGDYPLKNLN------VVIPDPDILTFDLDKLQPEFMILASDGL 304

  Fly   508 WNVVTAQEAVDSVRKEHLIGEILNEQDVMNPSKALVDQALKTWAAKKMRADNTSVVTVILTPAAR 572
            |:..:.:|||      ..|.|.|:|...  .:|::|.|:.....     .||.:|:.|    ..|
Human   305 WDAFSNEEAV------RFIKERLDEPHF--GAKSIVLQSFYRGC-----PDNITVMVV----KFR 352

  Fly   573 NNSPT 577
            |:|.|
Human   353 NSSKT 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 99/317 (31%)
PPM1LNP_640338.2 PP2Cc 93..351 CDD:238083 99/319 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.