DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2C1 and Pp2d1

DIOPT Version :9

Sequence 1:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_775625.1 Gene:Pp2d1 / 110332 MGIID:3612067 Length:620 Species:Mus musculus


Alignment Length:438 Identity:88/438 - (20%)
Similarity:133/438 - (30%) Gaps:138/438 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 FFGIYDGHGGPEAA-LFAKEHLMLEI-------------VKQKQFWSDQDE-------------- 327
            |||::|.|.|..|| |.:||..:|.:             .:|||..:..|.              
Mouse   206 FFGLFDSHYGYAAADLASKEFQVLLLHQLSIQDPSYQMTAEQKQLINSFDTVFREEYRAREEAFS 270

  Fly   328 ---DVLRAIREGYIATH----FAMWREQE--KWPRTANGHLSTAGTTATVAFMRR---------- 373
               ...|..|..|..||    .|.||...  :..|.....:..:|.:|....:..          
Mouse   271 STYKTFRTSRREYEDTHKAFAKAFWRMDRLLRLGRNETSRVRWSGCSALTCILEGGIKNPHANKD 335

  Fly   374 -EKIYIGHVGDSGI-----------VLGYQNKGE------RNWRARPLTTDHKPESLAEKTRIQR 420
             ||.|  ..|.:.:           ||...|.|.      ||.:...||.:|...:..|:.|:..
Mouse   336 WEKTY--QQGSTSLPFQKTPQIISGVLHLANAGNVQAVLCRNGKGFCLTKEHSTRNTKERRRVLY 398

  Fly   421 SGGNVAIKSGVPRVVWNRPRDPMHRGPIRRRTLVDEIPFLAVARSLGDLWSYNSRFKEFVVSPDP 485
            |  ...|.|.          ||.        .|:|  ..:...|.||  :..|.|.|:.:: |.|
Mouse   399 S--EAVISSD----------DPY--------GLLD--GHIKTTRGLG--FHGNLRLKKSII-PAP 438

  Fly   486 DVKVVKINPSTFRCLIFGTDGLWNVVTAQEAVDSVRKEHLIGEILNEQDVMNPSKALVDQALKTW 550
            ....|.|: ...:.||..|:|||.|:..:|....|   ..:.....|..|..|..       |.|
Mouse   439 QTISVPID-DLCQFLILATNGLWQVLDKKEVTALV---ITLFHAYKETHVPRPKS-------KPW 492

  Fly   551 AAKKMRADNTSVVTVILTPAARNNSPTTPTRSPSAMARDNDLEVELLLE---EDDEELPTLDVEN 612
                                           .|..:....|..:.:|.:   |:::.:.|.|...
Mouse   493 -------------------------------PPIGLLSPPDSNIRVLFQYQPENEDIMSTADGTK 526

  Fly   613 NYPDFLIEEHEYVLDQPYSALAKRHSPPEAFRNFDYFDVDEDELDEDE 660
            ...|.:..| .|.....:|.....:.|.....|.....:|..:.:|.|
Mouse   527 GLSDSIYAE-AYTHQGTFSPKVTPYDPCSTKENSSLPTIDSKQENEKE 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 73/340 (21%)
Pp2d1NP_775625.1 PP2Cc 187..472 CDD:238083 67/293 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.