DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and pla2g3

DIOPT Version :9

Sequence 1:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001032489.1 Gene:pla2g3 / 641423 ZFINID:ZDB-GENE-051113-96 Length:528 Species:Danio rerio


Alignment Length:287 Identity:86/287 - (29%)
Similarity:120/287 - (41%) Gaps:63/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ISDMTMSVMVELSSRHPFCKMHTDRGDIQRMLLQSDPRRIRQVPRE---------SVMELE---- 83
            |:|..||..:|.||   |.::..:|.||..:.....|..:..|..|         .:|.:|    
Zfish    77 ITDSYMSRCLEDSS---FSELLDERFDISVLTEADGPCEVAGVTEEFAASVRRARDLMSVEPDGF 138

  Fly    84 -EVCRRQGSYGHEFRGGLGFIYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGEC 147
             |......|.....|....::.|||.|||.|..||.:.|||.....|:||||||.|...:.....
Zfish   139 VEQDSDVSSIKTLQRSKRAWMIPGTLWCGSGNKATGWTDLGVFEETDKCCREHDHCKHTIPSFSY 203

  Fly   148 RRGLCNRGTFTRSHCDCDARFRRCLQAANTETANTLGAIFYNVVQVTCFQ--ERSPC-------- 202
            ..|:.|...||.||||||.||||||...|...:|.:|..|:||::::||:  :|:.|        
Zfish   204 DHGVFNTNLFTLSHCDCDNRFRRCLLGVNNSMSNLVGYGFFNVLKMSCFKFSQRTQCAKRTWWGR 268

  Fly   203 ------SAHQRFEDFYYRTDHCPAE--------FRQADLYVPPHGDNLIAK------ILAHPQGR 247
                  :.:...:|....||..|.:        |:||...    |.|.:.|      |:.....|
Zfish   269 CVMSELAQYAVVKDAANYTDTLPEQEMESLETSFQQAITI----GQNQVTKNMEESLIIQSKDSR 329

  Fly   248 ----ALA------APSWT--IPAKSTA 262
                ||:      .||.|  :|.||.|
Zfish   330 NGTEALSPVSTSPGPSVTTLLPRKSEA 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 44/97 (45%)
pla2g3NP_001032489.1 PLA2_bee_venom_like 158..254 CDD:153093 44/95 (46%)
PLA2_like <374..450 CDD:297013
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6656
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003412
OrthoInspector 1 1.000 - - otm25517
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5827
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.