DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3009 and oc90

DIOPT Version :9

Sequence 1:	NP_001162665.1	Gene:	CG3009 / 31402	FlyBaseID:	FBgn0029720	Length:	342	Species:	Drosophila melanogaster
Sequence 2:	NP_001073661.1	Gene:	oc90 / 568941	ZFINID:	ZDB-GENE-070912-300	Length:	939	Species:	Danio rerio

Alignment Length:	137	Identity:	33/137 - (24%)
Similarity:	44/137 - (32%)	Gaps:	45/137 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   110 CGPGTAATSYDDLGAHA----------REDRCCREHDMCPDVLNVGECR--RGL-----CNRG-- 155
            |..|.....|...|.:.          |.||||.....|.:.|:|..||  |.|     |::.
Zfish   746 CLTGRCPHEYQHYGCYCGQQGTGQPVDRLDRCCFLQQCCLEQLSVFGCRTNRKLNAHISCHKAKP 810

  Fly   156 -TFTRSHCD-----CDARFRRCLQAANTETANTLGAIFYNVVQVTCFQERSPCSAHQRFEDFYYR 214
             .|..|.||     ||.....|:.|::          |.:....:|...|..|          .|
Zfish   811 QCFGVSVCDRLQCVCDRSTAECMAASH----------FNSSASSSCSGPRPLC----------LR 855

  Fly   215 TDHCPAE 221
            |.|..|:
Zfish   856 TAHSSAQ 862

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3009	NP_001162665.1	PLA2_bee_venom_like	102..198	CDD:153093	27/112 (24%)
oc90	NP_001073661.1	PLA2_like	62..166	CDD:297013
oc90	NP_001073661.1	otoconin_90	739..833	CDD:153096	23/86 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1422829at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010