powered by:
Protein Alignment CG3009 and Proca1
DIOPT Version :9
Sequence 1: | NP_001162665.1 |
Gene: | CG3009 / 31402 |
FlyBaseID: | FBgn0029720 |
Length: | 342 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001020929.1 |
Gene: | Proca1 / 497959 |
RGDID: | 1561727 |
Length: | 311 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 21/69 - (30%) |
Similarity: | 32/69 - (46%) |
Gaps: | 8/69 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 PGTKWCGPGTAATSYD----DLGAHAREDRCCREHDMCP--DVLNVGECRRGLCNRGTFTRSHCD 163
|..|...|.:..:|.| ..|.:...:|||.:|..|| .:.:..:| |..||.....|||:
Rat 33 PSWKRGYPASVESSSDMSSFSEGENKETERCCWKHQQCPVHIIHSFSDC--GHHNRCMHAVSHCN 95
Fly 164 CDAR 167
|::|
Rat 96 CESR 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12253 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.