DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and Proca1

DIOPT Version :9

Sequence 1:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001020929.1 Gene:Proca1 / 497959 RGDID:1561727 Length:311 Species:Rattus norvegicus


Alignment Length:69 Identity:21/69 - (30%)
Similarity:32/69 - (46%) Gaps:8/69 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PGTKWCGPGTAATSYD----DLGAHAREDRCCREHDMCP--DVLNVGECRRGLCNRGTFTRSHCD 163
            |..|...|.:..:|.|    ..|.:...:|||.:|..||  .:.:..:|  |..||.....|||:
  Rat    33 PSWKRGYPASVESSSDMSSFSEGENKETERCCWKHQQCPVHIIHSFSDC--GHHNRCMHAVSHCN 95

  Fly   164 CDAR 167
            |::|
  Rat    96 CESR 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 21/69 (30%)
Proca1NP_001020929.1 PLA2_group_III_like 30..125 CDD:153094 21/69 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..159
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..311
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.