DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and Proca1

DIOPT Version :10

Sequence 1:NP_572180.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001020929.1 Gene:Proca1 / 497959 RGDID:1561727 Length:311 Species:Rattus norvegicus


Alignment Length:69 Identity:21/69 - (30%)
Similarity:32/69 - (46%) Gaps:8/69 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PGTKWCGPGTAATSYD----DLGAHAREDRCCREHDMCP--DVLNVGECRRGLCNRGTFTRSHCD 163
            |..|...|.:..:|.|    ..|.:...:|||.:|..||  .:.:..:|  |..||.....|||:
  Rat    33 PSWKRGYPASVESSSDMSSFSEGENKETERCCWKHQQCPVHIIHSFSDC--GHHNRCMHAVSHCN 95

  Fly   164 CDAR 167
            |::|
  Rat    96 CESR 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_572180.1 PLA2_bee_venom_like 102..198 CDD:153093 21/69 (30%)
Proca1NP_001020929.1 PLA2_group_III_like 30..125 CDD:153094 21/69 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..159
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..311
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.