DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and Pla2g3

DIOPT Version :9

Sequence 1:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001099485.1 Gene:Pla2g3 / 289733 RGDID:1305323 Length:506 Species:Rattus norvegicus


Alignment Length:232 Identity:76/232 - (32%)
Similarity:104/232 - (44%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RHPFCKMHTDRGDIQRML--LQSD---PRRIRQVPRESVMELEEVCRRQGSYGHEFRGGLGFIYP 105
            ||.|  :||...::||.|  |||.   .||....| ....|..|...|....|...|...|:..|
  Rat    93 RHAF--IHTPGPELQRALATLQSQWEACRRSEASP-TGAREKRETEHRGAPAGEHQRRRRGWTIP 154

  Fly   106 GTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECRRGLCNRGTFTRSHCDCDARFRR 170
            ||.|||.|.:|.:..:||.....|.||||||.||..::..:...|:.|....|.|||||||||::
  Rat   155 GTLWCGVGNSAENASELGMFHGPDFCCREHDQCPQTISPLQYNYGIRNFRFHTISHCDCDARFQQ 219

  Fly   171 CLQAANTETANTLGAIFYNVVQVTCF--QERSPCSAHQRFEDFYYRTDHC------PAEFRQADL 227
            ||::.....|:.:|..|:||:::.||  :|:..|.|       ::....|      |....|...
  Rat   220 CLRSQGDSIADIMGVAFFNVLEIPCFVLKEQETCVA-------WHWWGGCRTYGSLPLAHLQPRT 277

  Fly   228 YVPPHGDNLIAKILAHPQGRALAAPSWTI-PAKSTAR 263
            |...........:...||.   .||||.. |.::.||
  Rat   278 YYNASWKAEATPLTPSPQS---PAPSWKRGPQQTPAR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 40/97 (41%)
Pla2g3NP_001099485.1 PLA2_bee_venom_like 151..247 CDD:153093 40/95 (42%)
PLA2_group_III_like 299..424 CDD:153094 6/13 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7183
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12253
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.970

Return to query results.
Submit another query.