DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and CG30503

DIOPT Version :9

Sequence 1:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001137612.1 Gene:CG30503 / 246656 FlyBaseID:FBgn0050503 Length:173 Species:Drosophila melanogaster


Alignment Length:149 Identity:55/149 - (36%)
Similarity:70/149 - (46%) Gaps:9/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 YGHEFRGGLGFIYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECRRGLCNRGT 156
            |......||....|||||||||..|.:|||||.....|.|||.||.|.:.:...|...||.|.|.
  Fly    16 YASHAAAGLSITVPGTKWCGPGNIAANYDDLGTEREVDTCCRAHDNCEEKIPPLEEAFGLRNDGF 80

  Fly   157 FTRSHCDCDARFRRCLQAANTETANTLGAIFYNVVQVTCFQERSP-CSAHQRFEDFY------YR 214
            |....|.|::.||.||.|.....:..||.|::|..:| ||....| .|..::..|.:      ||
  Fly    81 FPIFSCACESAFRNCLTALRNGHSLALGKIYFNTKEV-CFGYGHPIVSCQEKQADLFETRCLSYR 144

  Fly   215 TDH-CPAEFRQADLYVPPH 232
            .|. .|..::..||.:..|
  Fly   145 VDEGQPQRWQFYDLALYTH 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 42/95 (44%)
CG30503NP_001137612.1 Phospholip_A2_2 28..121 CDD:368629 42/93 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8069
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.