DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and Proca1

DIOPT Version :9

Sequence 1:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001355805.1 Gene:Proca1 / 216974 MGIID:1918274 Length:307 Species:Mus musculus


Alignment Length:117 Identity:27/117 - (23%)
Similarity:41/117 - (35%) Gaps:30/117 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IQRMLLQSDPRRIRQVPRESVMELEEVCRRQGSYGHEFRGGLGFIYPGTKWCGPGTAATSYD--- 120
            ::|...:...|:|.:..|..:..|                      |..|...|.:..:|.|   
Mouse     9 VKRWTEERSGRKIERTERTDITRL----------------------PSWKRGYPASVDSSSDLFS 51

  Fly   121 -DLGAHAREDRCCREHDMCP--DVLNVGECRRGLCNRGTFTRSHCDCDARFR 169
             ..|.:...||.|.:|..||  .:....:|  |..||.....|.|||::|.|
Mouse    52 FSEGENKETDRRCWKHQHCPGHTIHPFSDC--GHHNRCMHAVSQCDCESRCR 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 22/74 (30%)
Proca1NP_001355805.1 PLA2_group_III_like 30..123 CDD:153094 23/96 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..155
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.