DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and Proca1

DIOPT Version :10

Sequence 1:NP_572180.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001355805.1 Gene:Proca1 / 216974 MGIID:1918274 Length:307 Species:Mus musculus


Alignment Length:117 Identity:27/117 - (23%)
Similarity:41/117 - (35%) Gaps:30/117 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IQRMLLQSDPRRIRQVPRESVMELEEVCRRQGSYGHEFRGGLGFIYPGTKWCGPGTAATSYD--- 120
            ::|...:...|:|.:..|..:..|                      |..|...|.:..:|.|   
Mouse     9 VKRWTEERSGRKIERTERTDITRL----------------------PSWKRGYPASVDSSSDLFS 51

  Fly   121 -DLGAHAREDRCCREHDMCP--DVLNVGECRRGLCNRGTFTRSHCDCDARFR 169
             ..|.:...||.|.:|..||  .:....:|  |..||.....|.|||::|.|
Mouse    52 FSEGENKETDRRCWKHQHCPGHTIHPFSDC--GHHNRCMHAVSQCDCESRCR 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_572180.1 PLA2_bee_venom_like 102..198 CDD:153093 22/74 (30%)
Proca1NP_001355805.1 PLA2_group_III_like 30..123 CDD:153094 23/96 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..155
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..307
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.